ELA2, Mouse, Clone: 1A11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ELA2.

Manufacturer: Abnova Corporation H00001991M07

Catalog No. 89-021-423

  Check Availability
Add to Cart

    Specifications

    Antigen ELA2
    Applications Enzyme Linked Immunosorbent Assay,Sandwich ELISA
    Clone 1A11
    Conjugate Unlabeled
    Cross Reactivity Human
    Description elastase 2, neutrophil
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene ELA2
    Gene Accession No. NM_001972
    Gene Alias GE, HLE, HNE, NE, PMN-E
    Gene Symbols ELA2
    Host Species Mouse
    Immunogen ELA2 (NP_001963, 168 a.a. ∽ 267 a.a) partial recombinant protein with GST tag
    Isotype IgG2a, κ
    Quantity 50μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1991

    Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins. The product of this gene hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix following the protein's release from activated neutrophils. The enzyme may play a role in degenerative and inflammatory diseases by its proteolysis of collagen-IV and elastin of the extracellular matrix. This protein degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is clustered with other serine protease gene family members, azurocidin 1 and proteinase 3 genes, at chromosome 19pter. All 3 genes are expressed coordinately and their protein products are packaged together into azurophil granules during neutrophil differentiation. [provided by RefSeq

    Sequence: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit