E74-like factor 3 (ets domain transcription factor, epithelial-specific ), Mouse, Clone: 2B11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ELF3.

Supplier:  Abnova Corporation H00001999M02

Catalog No. 89-000-623

Description

Sequence: EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN

Specifications

• Antigen: E74-like factor 3 (ets domain transcription factor, epithelial-specific )
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC003569
• Gene Symbols: ELF3
• Immunogen: ELF3 (AAH03569, 262 a.a. ∼ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2B11
• Description: Mouse monoclonal antibody raised against a partial recombinant ELF3.
• Gene: ELF3
• Gene Alias: EPR-1/ERT/ESE-1/ESX
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 1999
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ