Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021437

ELF4, Mouse, Clone: 1E10, Abnova™

Catalog No. 89021437 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-437 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-437 Supplier Abnova Corporation Supplier No. H00002000M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ELF4.

ELF4 is a member of the ETS (see MIM 164720) gene family of transcription factors (Aryee et al., 1998 [PubMed 9524226]). ELF4 is involved in inducing cell cycle arrest in naive CD8+ T cells (Yamada et al., 2009 [PubMed 19412182]).[supplied by OMIM

Sequence: IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV

Specifications

Antigen ELF4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1E10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ELF4.
Formulation PBS with no preservative; pH 7.4
Gene ELF4
Gene Accession No. NM_001421
Gene Alias ELFR/MEF
Gene Symbols ELF4
Host Species Mouse
Immunogen ELF4 (NP_001412, 521 a.a. ∼ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2000
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.