Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ELF5, Mouse, Clone: 3D10, Abnova™

Catalog No. 89021438 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-438 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-438 Supplier Abnova Corporation Supplier No. H00002001M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ELF5.

The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED

Specifications

Antigen ELF5
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3D10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ELF5.
Formulation PBS with no preservative; pH 7.4
Gene ELF5
Gene Accession No. NM_198381
Gene Alias ESE2
Gene Symbols ELF5
Host Species Mouse
Immunogen ELF5 (NP_938195.1, 166 a.a. ∼ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2001
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.