echinoderm microtubule associated protein like 1, Mouse, Clone: 5G3, Abnova™

Catalog No.	Quantity
89-001-447	200 μL

Catalog No. 89-001-447 Supplier Abnova Corporation Supplier No. H00002009M01A

Description

Mouse monoclonal antibody raised against a partial recombinant EML1.

Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type. The disease process in USHs involves the entire brain and is not limited to the posterior fossa or auditory and visual systems. The USHs are catagorized as type I (USH1A, USH1B, USH1C, USH1D, USH1E and USH1F), type II (USH2A and USH2B) and type III (USH3). The type I is the most severe form. Gene loci responsible for these three types are all mapped. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNN

Specifications

• Antigen: echinoderm microtubule associated protein like 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5G3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EML1.
• Formulation: ascites with no preservative
• Gene: EML1
• Gene Accession No.: NM_001008707
• Gene Alias: ELP79/EMAP/EMAPL/FLJ45033/HuEMAP
• Gene Symbols: EML1
• Host Species: Mouse
• Immunogen: EML1 (NP_001008707, 1 a.a. ∼ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2009
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ