EMR4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EMR4.

Supplier:  Abnova Corporation H00326342A01

Catalog No. 89-003-180

Description

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq

Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG

Specifications

• Antigen: EMR4
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant EMR4.
• Gene: EMR4P
• Gene Alias: EMR4/FIRE/GPR127/PGR16
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: XM_377506
• Gene Symbols: EMR4P
• Immunogen: EMR4 (XP_377506, 21 a.a. ∼ 93 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 326342
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.