EMR4P, Mouse, Clone: 1G10, Abnova™

Catalog No.	Quantity
89-002-661	100 μg

Catalog No. 89-002-661 Supplier Abnova Corporation Supplier No. H00326342M02

Description

Mouse monoclonal antibody raised against a partial recombinant EMR4P.

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq

Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG

Specifications

• Antigen: EMR4P
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1G10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EMR4P.
• Formulation: PBS with no preservative; pH 7.4
• Gene: EMR4P
• Gene Accession No.: XM_377506
• Gene Alias: EMR4/FIRE/GPR127/PGR16
• Gene Symbols: EMR4P
• Host Species: Mouse
• Immunogen: EMR4P (XP_377506, 21 a.a. ∼ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 326342
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ