EMX2, Mouse, Clone: 3H8, Abnova™

Catalog No.	Quantity
89-021-448	100 μg

Catalog No. 89-021-448 Supplier Abnova Corporation Supplier No. H00002018M07

Description

Mouse monoclonal antibody raised against a partial recombinant EMX2.

This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins

Sequence: HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV

Specifications

• Antigen: EMX2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3H8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EMX2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: EMX2
• Gene Accession No.: NM_004098
• Gene Symbols: EMX2
• Host Species: Mouse
• Immunogen: EMX2 (NP_004089, 103 a.a. ∼ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2018
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ