engrailed homeobox 1, Mouse, Clone: 3H2, Abnova™

Catalog No.	Quantity
89-000-626	100 μg

Catalog No. 89-000-626 Supplier Abnova Corporation Supplier No. H00002019M04

Description

Mouse monoclonal antibody raised against a full-length recombinant EN1.

Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq]

Sequence: SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE*

Specifications

• Antigen: engrailed homeobox 1
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3H2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant EN1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: EN1
• Gene Accession No.: NM_001426
• Gene Symbols: EN1
• Host Species: Mouse
• Immunogen: EN1 (NP_001417, 266 a.a. ∼ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2019
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ