ENC1, Mouse, Clone: 3C10, Abnova™

Catalog No.	Quantity
89-002-730	100 μg

Catalog No. 89-002-730 Supplier Abnova Corporation Supplier No. H00008507M03

Description

Mouse monoclonal antibody raised against a partial recombinant ENC1.

DNA damage and/or hyperproliferative signals activate wildtype p53 tumor suppressor protein (TP53; MIM 191170), inducing cell cycle arrest or apoptosis. Mutations that inactivate p53 occur in 50% of all tumors. Polyak et al. (1997) [PubMed 9305847] used serial analysis of gene expression (SAGE) to evaluate cellular mRNA levels in a colorectal cancer cell line transfected with p53. Of 7,202 transcripts identified, only 14 were expressed at levels more than 10-fold higher in p53-expressing cells than in control cells. Polyak et al. (1997) [PubMed 9305847] termed these genes 'p53-induced genes,' or PIGs, several of which were predicted to encode redox-controlling proteins. They noted that reactive oxygen species (ROS) are potent inducers of apoptosis. Flow cytometric analysis showed that p53 expression induces ROS production, which increases as apoptosis progresses under some conditions. The authors stated that the PIG10 gene, also called ENC1, encodes an actin-binding protein.[supplied by OMIM

Sequence: SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL

Specifications

• Antigen: ENC1,
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3C10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ENC1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ENC1
• Gene Accession No.: NM_003633
• Gene Alias: CCL28/ENC-1/FLJ39259/KLHL35/KLHL37/NRPB/PIG10/TP53I10
• Gene Symbols: ENC1
• Host Species: Mouse
• Immunogen: ENC1 (NP_003624, 17 a.a. ∼ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8507
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ