Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021459

ENO3 (M01), Mouse anti-Human, Clone: 5D1, Abnova™

Catalog No. 89021459 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-459 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-459 Supplier Abnova Corporation Supplier No. H00002027M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ENO3.

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR. [provided by RefSeq]

Sequence: KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG

Specifications

Antigen ENO3
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
Classification Monoclonal
Clone 5D1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ENO3.
Formulation PBS with no preservative; pH 7.4
Gene ENO3
Gene Accession No. NM_001976
Gene Alias MSE
Gene Symbols ENO3
Host Species Mouse
Immunogen ENO3 (NP_001967, 228 a.a. ∼ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2027
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.