ENSA, Mouse, Clone: 1E8, Abnova™

Catalog No.	Quantity
89-021-462	200 μL

Catalog No. 89-021-462 Supplier Abnova Corporation Supplier No. H00002029M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant ENSA.

The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

Specifications

• Antigen: ENSA
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1E8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant ENSA.
• Formulation: ascites with no preservative
• Gene: ENSA
• Gene Accession No.: BC000436
• Gene Alias: MGC4319/MGC78563/MGC8394
• Gene Symbols: ENSA
• Host Species: Mouse
• Immunogen: ENSA (AAH00436, 1 a.a. ∼ 121 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2029
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ