Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021000

ENTPD6, Mouse, Clone: 2D10, Abnova™

Catalog No. 89021000 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-000 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-000 Supplier Abnova Corporation Supplier No. H00000955M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ENTPD6.

ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS

Specifications

Antigen ENTPD6
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 2D10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ENTPD6.
Formulation PBS with no preservative; pH 7.4
Gene ENTPD6
Gene Accession No. NM_001247
Gene Alias CD39L2/DKFZp781G2277/DKFZp781K21102/FLJ36711/IL-6SAG/IL6ST2/NTPDase-6/dJ738P15.3
Gene Symbols ENTPD6
Host Species Mouse
Immunogen ENTPD6 (NP_001238, 386 a.a. ∼ 484 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 955
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.