EPB41, Mouse, Clone: 3D9, Abnova™

Catalog No.	Quantity
89-021-466	100 μg

Catalog No. 89-021-466 Supplier Abnova Corporation Supplier No. H00002035M01

Description

Mouse monoclonal antibody raised against a partial recombinant EPB41.

Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene (MIM 182860), the beta-spectrin gene (MIM 182870), or the band 3 gene (MIM 109270).[supplied by OMIM

Sequence: IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV

Specifications

• Antigen: EPB41
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3D9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EPB41.
• Formulation: PBS with no preservative; pH 7.4
• Gene: EPB41
• Gene Accession No.: BC039079
• Gene Alias: 4.1R/EL1/HE
• Gene Symbols: EPB41
• Host Species: Mouse
• Immunogen: EPB41 (AAH39079, 116 a.a. ∼ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2035
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ