Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021467

EPB41L1, Mouse, Clone: 2D10, Abnova™

Catalog No. 89021467 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-467 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-467 Supplier Abnova Corporation Supplier No. H00002036M09
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant EPB41L1.

Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The protein encoded by this gene is a neuronally-enriched protein that is structurally similar to EPB41. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them has been determined. [provided by RefSeq

Sequence: MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN

Specifications

Antigen EPB41L1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2D10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EPB41L1.
Formulation PBS with no preservative; pH 7.4
Gene EPB41L1
Gene Accession No. NM_177996
Gene Alias 4.1N/DKFZp686H17242/KIAA0338/MGC11072
Gene Symbols EPB41L1
Host Species Mouse
Immunogen EPB41L1 (NP_818932, 1 a.a. ∼ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2036
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.