EPHA2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-264	50 μL

Catalog No. 89-003-264 Supplier Abnova Corporation Supplier No. H00001969A01

Description

Mouse polyclonal antibody raised against a partial recombinant EPHA2.

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. [provided by RefSeq

Sequence: LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT

Specifications

• Antigen: EPHA2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EPHA2.
• Formulation: 50% glycerol
• Gene: EPHA2
• Gene Accession No.: BC037166
• Gene Alias: ECK
• Gene Symbols: EPHA2
• Host Species: Mouse
• Immunogen: EPHA2 (AAH37166, 204 a.a. ∼ 326 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1969
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid