EPHA5, Mouse, Clone: 6F4, Abnova™

Catalog No.	Quantity
89-021-470	100 μg

Catalog No. 89-021-470 Supplier Abnova Corporation Supplier No. H00002044M03

Description

Mouse monoclonal antibody raised against a partial recombinant EPHA5.

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Sequence: PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS

Specifications

• Antigen: EPHA5
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6F4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EPHA5.
• Formulation: PBS with no preservative; pH 7.4
• Gene: EPHA5
• Gene Accession No.: NM_004439
• Gene Alias: CEK7/EHK1/HEK7/TYRO4
• Gene Symbols: EPHA5
• Host Species: Mouse
• Immunogen: EPHA5 (NP_004430, 234 a.a. ∼ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2044
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ