Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EPHB3, Mouse, Clone: 2G8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EPHB3.

Manufacturer:  Abnova Corporation H00002049M04

Catalog No. 89-021-479


  Check Availability
Add to cart

Specifications

Description

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq

Sequence: AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
Description & Specifications

Specifications

EPHB3
2G8
Human
Liquid
EPHB3
ETK2, HEK2, TYRO6
Murine
IgG2a, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
EPH receptor B3
In 1X PBS, pH 7.4
NM_004443
EPHB3
EPHB3 (NP_004434, 899 a.a. ∽ 997 a.a) partial recombinant protein with GST tag
100μg
Human
Primary
2049
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit