EPHB3 (M04A), Mouse anti-Human, Clone: 2G8, Abnova™

Catalog No.	Quantity
89-021-480	200 μL

Catalog No. 89-021-480 Supplier Abnova Corporation Supplier No. H00002049M04A

Description

Mouse monoclonal antibody raised against a partial recombinant EPHB3.

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq

Sequence: AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ

Specifications

• Antigen: EPHB3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2G8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EPHB3.
• Formulation: ascites with no preservative
• Gene: EPHB3
• Gene Accession No.: NM_004443
• Gene Alias: ETK2/HEK2/TYRO6
• Gene Symbols: EPHB3
• Host Species: Mouse
• Immunogen: EPHB3 (NP_004434, 899 a.a. ∼ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2049
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ