EPHB3, Mouse, Clone: 2G8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EPHB3.

Manufacturer: Abnova Corporation H00002049M04A

Catalog No. 89-021-480

  Check Availability
Add to Cart

    Specifications

    Antigen EPHB3
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 2G8
    Conjugate Unlabeled
    Cross Reactivity Human
    Description EPH receptor B3
    Format Ascites
    Formulation In ascites fluid
    Gene EPHB3
    Gene Accession No. NM_004443
    Gene Alias ETK2, HEK2, TYRO6
    Gene Symbols EPHB3
    Host Species Mouse
    Immunogen EPHB3 (NP_004434, 899 a.a. ∽ 997 a.a) partial recombinant protein with GST tag
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 2049

    Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq

    Sequence: AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit