EPH receptor B6, Mouse, Clone: 5D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EPHB6.

Supplier:  Abnova Corporation H00002051M03

Catalog No. 89-000-636

Description

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The ephrin receptor encoded by this gene lacks the kinase activity of most receptor tyrosine kinases and binds to ephrin-B ligands. [provided by RefSeq

Sequence: DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE

Specifications

• Antigen: EPH receptor B6
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004445
• Gene Symbols: EPHB6
• Immunogen: EPHB6 (NP_004436, 23 a.a. ∼ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 5D8
• Description: Mouse monoclonal antibody raised against a partial recombinant EPHB6.
• Gene: EPHB6
• Gene Alias: HEP/MGC129910/MGC129911
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2051
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ