Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

epilepsy, progressive myoclonus type 2A, Lafora disease (laforin), Mouse, Clone: 6C6, Abnova™

Catalog No. 89014216 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-216 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-216 Supplier Abnova Corporation Supplier No. H00007957M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant EPM2A.

This gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV

Specifications

Antigen epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6C6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EPM2A.
Formulation PBS with no preservative; pH 7.4
Gene EPM2A
Gene Accession No. NM_001018041
Gene Alias EPM2/MELF
Gene Symbols EPM2A
Host Species Mouse
Immunogen EPM2A (NP_001018051, 101 a.a. ∼ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7957
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.