epilepsy, progressive myoclonus type 2A, Lafora disease (laforin), Mouse, Clone: 6C6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EPM2A.

Supplier:  Abnova Corporation H00007957M02

Catalog No. 89-014-216

Description

This gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV

Specifications

• Antigen: epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001018041
• Gene Symbols: EPM2A
• Immunogen: EPM2A (NP_001018051, 101 a.a. ∼ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 6C6
• Description: Mouse monoclonal antibody raised against a partial recombinant EPM2A.
• Gene: EPM2A
• Gene Alias: EPM2/MELF
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7957
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ