erythropoietin, Mouse, Clone: 4G7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant EPO.

Supplier:  Abnova Corporation H00002056M01

Catalog No. 89-000-637

Description

This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. [provided by RefSeq

Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Specifications

• Antigen: erythropoietin
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000799.1
• Gene Symbols: EPO
• Immunogen: EPO (NP_000790.1, 28 a.a. ∼ 193 a.a) full-length recombinant protein.
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4G7
• Description: Mouse monoclonal antibody raised against a full-length recombinant EPO.
• Gene: EPO
• Gene Alias: EP/MGC138142
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2056
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ