ERBB2, Mouse, Clone: 4E1, Abnova™

Catalog No.	Quantity
89-021-490	100 μg

Catalog No. 89-021-490 Supplier Abnova Corporation Supplier No. H00002064M04

Description

Mouse monoclonal antibody raised against a partial recombinant ERBB2.

This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq

Sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD

Specifications

• Antigen: ERBB2
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4E1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ERBB2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ERBB2
• Gene Accession No.: NM_004448
• Gene Alias: CD340/HER-2/HER-2/neu/HER2/NEU/NGL/TKR1
• Gene Symbols: ERBB2
• Host Species: Mouse
• Immunogen: ERBB2 (NP_004439, 22 a.a. ∼ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2064
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ