ERBB3, Mouse, Clone: 2A4, Abnova™

Catalog No.	Quantity
89-021-494	100 μg

Catalog No. 89-021-494 Supplier Abnova Corporation Supplier No. H00002065M03

Description

Mouse monoclonal antibody raised against a full-length recombinant ERBB3.

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq

Sequence: EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF

Specifications

• Antigen: ERBB3
• Applications: ELISA, Immunohistochemistry (PFA fixed)
• Classification: Monoclonal
• Clone: 2A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ERBB3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ERBB3
• Gene Accession No.: BC002706
• Gene Alias: ErbB-3/HER3/LCCS2/MDA-BF-1/MGC88033/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3
• Gene Symbols: ERBB3
• Host Species: Mouse
• Immunogen: ERBB3 (AAH02706, 21 a.a. ∼ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2065
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ