ERBB3, Mouse, Clone: 2C7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ERBB3.

Supplier:  Abnova Corporation H00002065M05

Catalog No. 89-021-496

Description

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq

Sequence: EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF

Specifications

• Antigen: ERBB3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC002706
• Gene Symbols: ERBB3
• Immunogen: ERBB3 (AAH02706, 21 a.a. ∼ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Immunohistochemistry (PFA fixed)
• Clone: 2C7
• Description: Mouse monoclonal antibody raised against a full length recombinant ERBB3.
• Gene: ERBB3
• Gene Alias: ErbB-3/HER3/LCCS2/MDA-BF-1/MGC88033/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2065
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid