ESM1 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-007-125	50 μL

Catalog No. 89-007-125 Supplier Abnova Corporation Supplier No. H00011082B01

Description

Mouse polyclonal antibody raised against a full-length human ESM1 protein.

This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

Specifications

• Antigen: ESM1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human ESM1 protein.
• Formulation: No additive
• Gene: ESM1
• Gene Accession No.: NM_007036.3
• Gene Alias: endocan
• Gene Symbols: ESM1
• Host Species: Mouse
• Immunogen: ESM1 (NP_008967.1, 1 a.a. ∼ 184 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11082
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum