estrogen receptor 2 (ER beta), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-116	50 μL

Catalog No. 89-004-116 Supplier Abnova Corporation Supplier No. H00002100A01

Description

Mouse polyclonal antibody raised against a partial recombinant ESR2.

This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. [provided by RefSeq

Sequence: ILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNR

Specifications

• Antigen: estrogen receptor 2 (ER beta)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ESR2.
• Formulation: 50% glycerol
• Gene: ESR2
• Gene Accession No.: NM_001437
• Gene Alias: ER-BETA/ESR-BETA/ESRB/ESTRB/Erb/NR3A2
• Gene Symbols: ESR2
• Host Species: Mouse
• Immunogen: ESR2 (NP_001428, 22 a.a. ∼ 121 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2100
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum