estrogen-related receptor alpha (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-117	50 μL

Catalog No. 89-004-117 Supplier Abnova Corporation Supplier No. H00002101A01

Description

Mouse polyclonal antibody raised against a partial recombinant ESRRA.

The protein encoded by this gene is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes. A processed pseudogene of ESRRA is located on chromosome 13q12.1. [provided by RefSeq

Sequence: LFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLK

Specifications

• Antigen: estrogen-related receptor alpha
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ESRRA.
• Formulation: 50% glycerol
• Gene: ESRRA
• Gene Accession No.: NM_004451
• Gene Alias: ERR1/ERRa/ERRalpha/ESRL1/NR3B1
• Gene Symbols: ESRRA
• Host Species: Mouse
• Immunogen: ESRRA (NP_004442, 231 a.a. ∼ 330 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2101
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum