ETV4, Mouse, Clone: 1A3-1D3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ETV4.

Supplier:  Abnova Corporation H00002118M02

Catalog No. 89-022-012

Description

Sequence: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY

Specifications

• Antigen: ETV4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC007242
• Gene Symbols: ETV4
• Immunogen: ETV4 (AAH07242, 1 a.a. ∼ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 1A3-1D3
• Description: Mouse monoclonal antibody raised against a full-length recombinant ETV4.
• Gene: ETV4
• Gene Alias: E1A-F/E1AF/PEA3/PEAS3
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2118
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid