Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ets variant 5, Mouse, Clone: 7C10, Abnova™

Catalog No. 89000645 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-645 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-645 Supplier Abnova Corporation Supplier No. H00002119M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ETV5.

Sequence: LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM

Specifications

Antigen ets variant 5
Applications ELISA, Western Blot
Classification Monoclonal
Clone 7C10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ETV5.
Formulation PBS with no preservative; pH 7.4
Gene ETV5
Gene Accession No. NM_004454
Gene Alias ERM
Gene Symbols ETV5
Host Species Mouse
Immunogen ETV5 (NP_004445, 181 a.a. ∼ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2119
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.