Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000646

even-skipped homeobox 1, Mouse, Clone: 3F4, Abnova™

Catalog No. 89000646 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-646 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-646 Supplier Abnova Corporation Supplier No. H00002128M04
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant EVX1.

This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. [provided by RefSeq

Sequence: ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQP

Specifications

Antigen even-skipped homeobox 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3F4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EVX1.
Formulation PBS with no preservative; pH 7.4
Gene EVX1
Gene Accession No. NM_001989
Gene Symbols EVX1
Host Species Mouse
Immunogen EVX1 (NP_001980, 2 a.a. ∼ 110 a.a)partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2128
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.