exostoses (multiple)-like 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EXTL1.

Supplier:  Abnova Corporation H00002134A01

Catalog No. 89-004-119

Description

This gene is a member of the multiple exostoses (EXT) family of glycosyltransferases, which function in the chain polymerization of heparan sulfate and heparin. The encoded protein harbors alpha 1,4- N-acetylglucosaminyltransferase activity, and is involved in chain elongation of heparan sulfate and possibly heparin. [provided by RefSeq

Sequence: AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTADT

Specifications

• Antigen: exostoses (multiple)-like 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant EXTL1.
• Gene: EXTL1
• Gene Alias: EXTL/MGC70794
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 2134
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004455
• Gene Symbols: EXTL1
• Immunogen: EXTL1 (NP_004446, 141 a.a. ∼ 241 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum