eyes absent homolog 1 (Drosophila), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-120	50 μL

Catalog No. 89-004-120 Supplier Abnova Corporation Supplier No. H00002138A01

Description

Mouse polyclonal antibody raised against a partial recombinant EYA1.

This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Four transcript variants encoding three distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSF

Specifications

• Antigen: eyes absent homolog 1 (Drosophila)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EYA1.
• Formulation: 50% glycerol
• Gene: EYA1
• Gene Accession No.: NM_000503
• Gene Alias: BOP/BOR/MGC141875
• Gene Symbols: EYA1
• Host Species: Mouse
• Immunogen: EYA1 (NP_000494, 100 a.a. ∼ 170 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2138
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum