Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

eyes absent homolog 2 (Drosophila), Mouse, Clone: 2F8, Abnova™

Catalog No. 89014106 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-106 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-106 Supplier Abnova Corporation Supplier No. H00002139M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant EYA2.

This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined. [provided by RefSeq

Sequence: PASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYG

Specifications

Antigen eyes absent homolog 2 (Drosophila)
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2F8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EYA2.
Formulation PBS with no preservative; pH 7.4
Gene EYA2
Gene Accession No. NM_172110
Gene Alias EAB1/MGC10614
Gene Symbols EYA2
Host Species Mouse
Immunogen EYA2 (NP_742108, 164 a.a. ∼ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2139
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.