eyes absent homolog 2 (Drosophila), Mouse, Clone: 2F8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EYA2.

Supplier:  Abnova Corporation H00002139M04

Catalog No. 89-014-106

Description

This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined. [provided by RefSeq

Sequence: PASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYG

Specifications

• Antigen: eyes absent homolog 2 (Drosophila)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_172110
• Gene Symbols: EYA2
• Immunogen: EYA2 (NP_742108, 164 a.a. ∼ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2F8
• Description: Mouse monoclonal antibody raised against a partial recombinant EYA2.
• Gene: EYA2
• Gene Alias: EAB1/MGC10614
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2139
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ