F11, Mouse, Clone: 2H8, Abnova™

Catalog No.	Quantity
89-022-025	100 μg

Catalog No. 89-022-025 Supplier Abnova Corporation Supplier No. H00002160M01

Description

Mouse monoclonal antibody raised against a partial recombinant F11.

This gene encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality. [provided by RefSeq

Sequence: SIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIK

Specifications

• Antigen: F11
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 2H8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant F11.
• Formulation: PBS with no preservative; pH 7.4
• Gene: F11
• Gene Accession No.: NM_000128
• Gene Alias: FXI/MGC141891
• Gene Symbols: F11
• Host Species: Mouse
• Immunogen: F11 (NP_000119, 286 a.a. ∼ 385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2160
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ