F12, Mouse, Clone: 3A3, Abnova™

Catalog No.	Quantity
89-022-026	100 μg

Catalog No. 89-022-026 Supplier Abnova Corporation Supplier No. H00002161M01

Description

Mouse monoclonal antibody raised against a partial recombinant F12.

This gene encodes coagulation factor XII which circulates in blood as a zymogen. This single chain zymogen is converted to a two-chain serine protease with an heavy chain (alpha-factor XIIa) and a light chain. The heavy chain contains two fibronectin-type domains, two epidermal growth factor (EGF)-like domains, a kringle domain and a proline-rich domain, whereas the light chain contains only a catalytic domain. On activation, further cleavages takes place in the heavy chain, resulting in the production of beta-factor XIIa light chain and the alpha-factor XIIa light chain becomes beta-factor XIIa heavy chain. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then to beta-factor XIIa. The active factor XIIa participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. It activates coagulation factors VII and XI. Defects in this gene do not cause any clinical symptoms and the sole effect is that whole-blood clotting time is prolonged. [provided by RefSeq

Sequence: GHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS

Specifications

• Antigen: F12
• Applications: ELISA, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 3A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant F12.
• Formulation: PBS with no preservative; pH 7.4
• Gene: F12
• Gene Accession No.: BC012390
• Gene Alias: HAE3/HAEX/HAF
• Gene Symbols: F12
• Host Species: Mouse
• Immunogen: F12 (AAH12390, 191 a.a. ∼ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2161
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ