F3 (M01), Mouse anti-Human, Clone: 4G4, Abnova™

Catalog No.	Quantity
89-022-022	100 μg

Catalog No. 89-022-022 Supplier Abnova Corporation Supplier No. H00002152M01

Description

Mouse monoclonal antibody raised against a partial recombinant F3.

This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. [provided by RefSeq

Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK

Specifications

• Antigen: F3
• Applications: ELISA, Immunoprecipitation, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 4G4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant F3.
• Formulation: In 1X PBS, pH 7.4
• Gene: F3
• Gene Accession No.: BC011029
• Gene Alias: CD142/TF/TFA
• Gene Symbols: F3
• Host Species: Mouse
• Immunogen: F3 (AAH11029, 45 a.a. ∼ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2152
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG2a κ