F8, Mouse, Clone: 1E8, Abnova™

Catalog No.	Quantity
89-022-023	100 μg

Catalog No. 89-022-023 Supplier Abnova Corporation Supplier No. H00002157M03

Description

Mouse monoclonal antibody raised against a partial recombinant F8.

This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder. [provided by RefSeq]

Sequence: KFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITF

Specifications

• Antigen: F8
• Applications: ELISA, In situ PLA
• Classification: Monoclonal
• Clone: 1E8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant F8.
• Formulation: PBS with no preservative; pH 7.4
• Gene: F8
• Gene Accession No.: NM_000132
• Gene Alias: AHF/DXS1253E/F8B/F8C/FVIII/HEMA
• Gene Symbols: F8
• Host Species: Mouse
• Immunogen: F8 (NP_000123, 213 a.a. ∼ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2157
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ