Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

coagulation factor VIII, procoagulant component, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human F8 protein.

Manufacturer:  Abnova Corporation H00002157B01

Catalog No. 89-005-331


Add to cart

Description

Description

This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder. [provided by RefSeq

Sequence: MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Specifications

Specifications

coagulation factor VIII, procoagulant component
Unconjugated
No additive
NM_019863.2
AHF|DXS1253E|F8B|F8C|FVIII|HEMA
Mouse
50 uL
Cell Adhesion
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human F8 protein.
F8
Serum
F8
F8 (NP_063916.1, 1 a.a. ~ 216 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
2157
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit