F9, Mouse, Clone: 2C9, Abnova™

Catalog No.	Quantity
89-022-024	100 μg

Catalog No. 89-022-024 Supplier Abnova Corporation Supplier No. H00002158M01

Description

Mouse monoclonal antibody raised against a partial recombinant F9.

This gene encodes vitamin K-dependent coagulation factor IX that circulates in the blood as an inactive zymogen. This factor is converted to an active form by factor XIa, which excises the activation peptide and thus generates a heavy chain and a light chain held together by one or more disulfide bonds. The role of this activated factor IX in the blood coagulation cascade is to activate factor X to its active form through interactions with Ca+2 ions, membrane phospholipids, and factor VIII. Alterations of this gene, including point mutations, insertions and deletions, cause factor IX deficiency, which is a recessive X-linked disorder, also called hemophilia B or Christmas disease. [provided by RefSeq]

Sequence: QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT

Specifications

• Antigen: F9
• Applications: ELISA, Immunoprecipitation, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 2C9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant F9.
• Formulation: PBS with no preservative; pH 7.4
• Gene: F9
• Gene Accession No.: NM_000133
• Gene Alias: FIX/HEMB/MGC129641/MGC129642/PTC
• Gene Symbols: F9
• Host Species: Mouse
• Immunogen: F9 (NP_000124, 96 a.a. ∼ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2158
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ