FABP2, Mouse, Clone: 2F7, Abnova™

Catalog No.	Quantity
89-022-045	100 μg

Catalog No. 89-022-045 Supplier Abnova Corporation Supplier No. H00002169M11

Description

Mouse monoclonal antibody raised against a partial recombinant FABP2.

The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family with nearly twenty identified members. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Intestinal fatty acid-binding protein 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. This gene has a polymorphism at codon 54 that identified an alanine-encoding allele and a threonine-encoding allele. Thr-54 protein is associated with increased fat oxidation and insulin resistance. [provided by RefSeq

Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL

Specifications

• Antigen: FABP2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2F7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FABP2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FABP2
• Gene Accession No.: NM_000134
• Gene Alias: FABPI/I-FABP/MGC133132
• Gene Symbols: FABP2
• Host Species: Mouse
• Immunogen: FABP2 (NP_000125.1, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2169
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ