fatty acid binding protein 5 (psoriasis-associated), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human FABP5 protein.

Supplier:  Abnova Corporation H00002171B02

Catalog No. 89-005-340

Description

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. The human genome contains many pseudogenes similar to this locus. [provided by RefSeq

Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Specifications

• Antigen: fatty acid binding protein 5 (psoriasis-associated)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human FABP5 protein.
• Gene: FABP5
• Gene Alias: E-FABP/EFABP/PA-FABP/PAFABP
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_001444
• Gene Symbols: FABP5
• Immunogen: FABP5 (NP_001435.1, 1 a.a. ∼ 135 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2171
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.