Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001121

Fas apoptotic inhibitory molecule 3, Mouse, Clone: 1E4, Abnova™

Catalog No. 89001121 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-121 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-121 Supplier Abnova Corporation Supplier No. H00009214M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant FAIM3.

Sequence: SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ

Specifications

Antigen Fas apoptotic inhibitory molecule 3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1E4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FAIM3.
Formulation PBS with no preservative; pH 7.4
Gene FAIM3
Gene Accession No. BC006401
Gene Alias TOSO
Gene Symbols FAIM3
Host Species Mouse
Immunogen FAIM3 (AAH06401, 124 a.a. ∼ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 9214
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.