anti-FAM73B, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP186701

Catalog No. NBP186701

Description

FAM73B Polyclonal specifically detects FAM73B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAM73B
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: C9orf54, chromosome 9 open reading frame 54, family with sequence similarity 73, member B, FLJ00199, FLJ14596, hypothetical protein LOC84895
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84895
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FAM73B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RTLMLPLTEGSLRLRADDEDSLTSEDSFFSATELFESLQTGDYPIPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQ
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only