FANCB, Mouse, Clone: 2B10, Abnova™

Catalog No.	Quantity
89-022-050	100 μg

Catalog No. 89-022-050 Supplier Abnova Corporation Supplier No. H00002187M01

Description

Mouse monoclonal antibody raised against a partial recombinant FANCB.

The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group B. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq

Sequence: GSENFLIDNMAFTLEKELVTLSSLSSAIAKHESNFMQRCEVSKGKSSVVAAALSDRRENIHPYRKELQREKKKMLQTNLKVSGALYREITLKVAEVQLKSDFAAQKLSN

Specifications

• Antigen: FANCB
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2B10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FANCB.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FANCB
• Gene Accession No.: NM_152633
• Gene Alias: FA2/FAAP90/FAAP95/FAB/FACB
• Gene Symbols: FANCB
• Host Species: Mouse
• Immunogen: FANCB (NP_689846.1, 750 a.a. ∼ 858 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2187
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ