phenylalanyl-tRNA synthetase, alpha subunit (A01), Mouse anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FARSLA.

Supplier:  Abnova Corporation H00002193A01

Catalog No. 89-004-122

Description

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a product which is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). This gene product has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase gene family shown to exhibit this type of regulated expression [provided by RefSeq

Sequence: KVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGS

Specifications

• Antigen: phenylalanyl-tRNA synthetase, alpha subunit
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant FARSLA.
• Gene: FARSA
• Gene Alias: CML33/FARSL/FARSLA/FRSA/PheHA
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 2193
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004461
• Gene Symbols: FARSA
• Immunogen: FARSLA (NP_004452, 101 a.a. ∼ 201 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Serum