Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

phenylalanyl-tRNA synthetase, alpha subunit (A01), Mouse anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant FARSLA.

Manufacturer:  Abnova Corporation H00002193A01

Catalog No. 89-004-122


Add to cart

Description

Description

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a product which is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). This gene product has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase gene family shown to exhibit this type of regulated expression [provided by RefSeq

Sequence: KVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGS
Specifications

Specifications

phenylalanyl-tRNA synthetase, alpha subunit
Unconjugated
50% glycerol
NM_004461
CML33|FARSL|FARSLA|FRSA|PheHA
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
2193
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant FARSLA.
FARSA
Serum
FARSA
FARSLA (NP_004452, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit