Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016187

FASLG, Mouse, Clone: 3F3, Abnova™

Catalog No. 89016187 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-187 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-187 Supplier Abnova Corporation Supplier No. H00000356M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant FASLG.

The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). [provided by RefSeq

Sequence: SGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Specifications

Antigen FASLG
Applications ELISA
Classification Monoclonal
Clone 3F3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FASLG.
Formulation PBS with no preservative; pH 7.4
Gene FASLG
Gene Accession No. NM_000639
Gene Alias APT1LG1/CD178/CD95L/FASL/TNFSF6
Gene Symbols FASLG
Host Species Mouse
Immunogen FASLG (AAH17502.1, 172 a.a. ∼ 281 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 356
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.