Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBLN1, Mouse, Clone: 4C9, Abnova™

Catalog No. 89022054 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-022-054 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-022-054 Supplier Abnova Corporation Supplier No. H00002192M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant FBLN1.

Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants. [provided by RefSeq]

Sequence: GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT

Specifications

Antigen FBLN1
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 4C9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FBLN1.
Formulation PBS with no preservative; pH 7.4
Gene FBLN1
Gene Accession No. BC022497
Gene Alias FBLN
Gene Symbols FBLN1
Host Species Mouse
Immunogen FBLN1 (AAH22497, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2192
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.