FBN1, Mouse, Clone: 3H6, Abnova™

Catalog No.	Quantity
89-022-063	100 μg

Catalog No. 89-022-063 Supplier Abnova Corporation Supplier No. H00002200M01

Description

Mouse monoclonal antibody raised against a partial recombinant FBN1.

This gene encodes a member of the fibrillin family. The encoded protein is a large, extracellular matrix glycoprotein that serve as a structural component of 10-12nm calcium-binding microfibrils. These microfibrils provide force bearing structural support in elastic and nonelastic connective tissue throughout the body. Mutations in this gene are associated with Marfan syndrome, isolated ectopia lentis, autosomal dominant Weill-Marchesani syndrome, MASS syndrome, and Shprintzen-Goldberg craniosynostosis syndrome. [provided by RefSeq

Sequence: SNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH

Specifications

• Antigen: FBN1
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3H6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant FBN1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: FBN1
• Gene Accession No.: NM_000138
• Gene Alias: FBN/MASS/MFS1/OCTD/SGS/WMS
• Gene Symbols: FBN1
• Host Species: Mouse
• Immunogen: FBN1 (NP_000129, 2772 a.a. ∼ 2871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2200
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ