F-box and leucine-rich repeat protein 17, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-712	50 μL

Catalog No. 89-004-712 Supplier Abnova Corporation Supplier No. H00064839A01

Description

Mouse polyclonal antibody raised against a partial recombinant FBXL17.

Members of the F-box protein family, such as FBXL17, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Sequence: QNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS

Specifications

• Antigen: F-box and leucine-rich repeat protein 17
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant FBXL17.
• Formulation: 50% glycerol
• Gene: FBXL17
• Gene Accession No.: NM_022824
• Gene Alias: DKFZp434C1715/FBXO13/Fbl17/Fbx13/MGC161422/MGC161424
• Gene Symbols: FBXL17
• Host Species: Mouse
• Immunogen: FBXL17 (NP_073735, 194 a.a. ∼ 303 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 64839
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum